CD46 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD46 purified MaxPab rabbit polyclonal antibody (D01P)

CD46 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004179-D01P
CD46 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD46 protein.
Información adicional
Size 100 ug
Gene Name CD46
Gene Alias MCP|MGC26544|MIC10|TLX|TRA2.10
Gene Description CD46 molecule, complement regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD46 (NP_722548.1, 1 a.a. ~ 384 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4179

Enviar un mensaje


CD46 purified MaxPab rabbit polyclonal antibody (D01P)

CD46 purified MaxPab rabbit polyclonal antibody (D01P)