MCM7 monoclonal antibody (M03), clone 1G1
  • MCM7 monoclonal antibody (M03), clone 1G1

MCM7 monoclonal antibody (M03), clone 1G1

Ref: AB-H00004176-M03
MCM7 monoclonal antibody (M03), clone 1G1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MCM7.
Información adicional
Size 100 ug
Gene Name MCM7
Gene Alias CDABP0042|CDC47|MCM2|P1.1-MCM3|P1CDC47|P85MCM|PNAS-146
Gene Description minichromosome maintenance complex component 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSSKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCM7 (AAH09398, 1 a.a. ~ 389 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4176
Clone Number 1G1
Iso type IgG2a Kappa

Enviar un mensaje


MCM7 monoclonal antibody (M03), clone 1G1

MCM7 monoclonal antibody (M03), clone 1G1