MCM7 purified MaxPab mouse polyclonal antibody (B01P)
  • MCM7 purified MaxPab mouse polyclonal antibody (B01P)

MCM7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004176-B01P
MCM7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MCM7 protein.
Información adicional
Size 50 ug
Gene Name MCM7
Gene Alias CDABP0042|CDC47|MCM2|P1.1-MCM3|P1CDC47|P85MCM|PNAS-146
Gene Description minichromosome maintenance complex component 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCM7 (NP_005907.3, 1 a.a. ~ 719 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4176

Enviar un mensaje


MCM7 purified MaxPab mouse polyclonal antibody (B01P)

MCM7 purified MaxPab mouse polyclonal antibody (B01P)