MCM6 purified MaxPab mouse polyclonal antibody (B01P)
  • MCM6 purified MaxPab mouse polyclonal antibody (B01P)

MCM6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004175-B01P
MCM6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MCM6 protein.
Información adicional
Size 50 ug
Gene Name MCM6
Gene Alias MCG40308|Mis5|P105MCM
Gene Description minichromosome maintenance complex component 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P,PLA-Ce,IF
Immunogen Prot. Seq MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCM6 (NP_005906.2, 1 a.a. ~ 821 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4175

Enviar un mensaje


MCM6 purified MaxPab mouse polyclonal antibody (B01P)

MCM6 purified MaxPab mouse polyclonal antibody (B01P)