MBD1 monoclonal antibody (M04), clone 2H3
  • MBD1 monoclonal antibody (M04), clone 2H3

MBD1 monoclonal antibody (M04), clone 2H3

Ref: AB-H00004152-M04
MBD1 monoclonal antibody (M04), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MBD1.
Información adicional
Size 100 ug
Gene Name MBD1
Gene Alias CXXC3|PCM1|RFT
Gene Description methyl-CpG binding domain protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4152
Clone Number 2H3
Iso type IgG2b Kappa

Enviar un mensaje


MBD1 monoclonal antibody (M04), clone 2H3

MBD1 monoclonal antibody (M04), clone 2H3