MARS monoclonal antibody (M01), clone 5G5
  • MARS monoclonal antibody (M01), clone 5G5

MARS monoclonal antibody (M01), clone 5G5

Ref: AB-H00004141-M01
MARS monoclonal antibody (M01), clone 5G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARS.
Información adicional
Size 100 ug
Gene Name MARS
Gene Alias FLJ35667|METRS|MTRNS
Gene Description methionyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARS (NP_004981, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4141
Clone Number 5G5
Iso type IgG1 Kappa

Enviar un mensaje


MARS monoclonal antibody (M01), clone 5G5

MARS monoclonal antibody (M01), clone 5G5