MAP4 monoclonal antibody (M03), clone 7C9
  • MAP4 monoclonal antibody (M03), clone 7C9

MAP4 monoclonal antibody (M03), clone 7C9

Ref: AB-H00004134-M03
MAP4 monoclonal antibody (M03), clone 7C9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MAP4.
Información adicional
Size 100 ug
Gene Name MAP4
Gene Alias DKFZp779A1753|MGC8617
Gene Description microtubule-associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4 (NP_112147.2, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4134
Clone Number 7C9
Iso type IgG2a Kappa

Enviar un mensaje


MAP4 monoclonal antibody (M03), clone 7C9

MAP4 monoclonal antibody (M03), clone 7C9