MANBA purified MaxPab rabbit polyclonal antibody (D01P)
  • MANBA purified MaxPab rabbit polyclonal antibody (D01P)

MANBA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004126-D01P
MANBA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MANBA protein.
Información adicional
Size 100 ug
Gene Name MANBA
Gene Alias MANB1
Gene Description mannosidase, beta A, lysosomal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFDVVSSKPVGGQVIVAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MANBA (AAH15743.1, 1 a.a. ~ 879 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4126

Enviar un mensaje


MANBA purified MaxPab rabbit polyclonal antibody (D01P)

MANBA purified MaxPab rabbit polyclonal antibody (D01P)