MAK purified MaxPab rabbit polyclonal antibody (D01P)
  • MAK purified MaxPab rabbit polyclonal antibody (D01P)

MAK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004117-D01P
MAK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAK protein.
Información adicional
Size 100 ug
Gene Name MAK
Gene Alias dJ417M14.2
Gene Description male germ cell-associated kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAK (AAH39825.1, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4117

Enviar un mensaje


MAK purified MaxPab rabbit polyclonal antibody (D01P)

MAK purified MaxPab rabbit polyclonal antibody (D01P)