MAGEA12 polyclonal antibody (A01)
  • MAGEA12 polyclonal antibody (A01)

MAGEA12 polyclonal antibody (A01)

Ref: AB-H00004111-A01
MAGEA12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAGEA12.
Información adicional
Size 50 uL
Gene Name MAGEA12
Gene Alias MAGE12
Gene Description melanoma antigen family A, 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAGEA12 (NP_005358, 70 a.a. ~ 168 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4111

Enviar un mensaje


MAGEA12 polyclonal antibody (A01)

MAGEA12 polyclonal antibody (A01)