MAGEA3 polyclonal antibody (A01)
  • MAGEA3 polyclonal antibody (A01)

MAGEA3 polyclonal antibody (A01)

Ref: AB-H00004102-A01
MAGEA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAGEA3.
Información adicional
Size 50 uL
Gene Name MAGEA3
Gene Alias HIP8|HYPD|MAGE3|MAGEA6|MGC14613
Gene Description melanoma antigen family A, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4102

Enviar un mensaje


MAGEA3 polyclonal antibody (A01)

MAGEA3 polyclonal antibody (A01)