MAGEA1 polyclonal antibody (A01)
  • MAGEA1 polyclonal antibody (A01)

MAGEA1 polyclonal antibody (A01)

Ref: AB-H00004100-A01
MAGEA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAGEA1.
Información adicional
Size 50 uL
Gene Name MAGEA1
Gene Alias MAGE1|MGC9326
Gene Description melanoma antigen family A, 1 (directs expression of antigen MZ2-E)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAGEA1 (NP_004979, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4100

Enviar un mensaje


MAGEA1 polyclonal antibody (A01)

MAGEA1 polyclonal antibody (A01)