MAF polyclonal antibody (A01)
  • MAF polyclonal antibody (A01)

MAF polyclonal antibody (A01)

Ref: AB-H00004094-A01
MAF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAF.
Información adicional
Size 50 uL
Gene Name MAF
Gene Alias MGC71685|c-MAF
Gene Description v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAF (NP_005351, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4094

Enviar un mensaje


MAF polyclonal antibody (A01)

MAF polyclonal antibody (A01)