SMAD5 monoclonal antibody (M03), clone 3A10
  • SMAD5 monoclonal antibody (M03), clone 3A10

SMAD5 monoclonal antibody (M03), clone 3A10

Ref: AB-H00004090-M03
SMAD5 monoclonal antibody (M03), clone 3A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMAD5.
Información adicional
Size 100 ug
Gene Name SMAD5
Gene Alias DKFZp781C1895|DKFZp781O1323|Dwfc|JV5-1|MADH5
Gene Description SMAD family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4090
Clone Number 3A10
Iso type IgG2a Kappa

Enviar un mensaje


SMAD5 monoclonal antibody (M03), clone 3A10

SMAD5 monoclonal antibody (M03), clone 3A10