SMAD4 monoclonal antibody (M15), clone 2E7
  • SMAD4 monoclonal antibody (M15), clone 2E7

SMAD4 monoclonal antibody (M15), clone 2E7

Ref: AB-H00004089-M15
SMAD4 monoclonal antibody (M15), clone 2E7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SMAD4.
Información adicional
Size 100 ug
Gene Name SMAD4
Gene Alias DPC4|JIP|MADH4
Gene Description SMAD family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD4 (NP_005350, 421 a.a. ~ 520 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4089
Clone Number 2E7
Iso type IgG2a Kappa

Enviar un mensaje


SMAD4 monoclonal antibody (M15), clone 2E7

SMAD4 monoclonal antibody (M15), clone 2E7