SMAD4 monoclonal antibody (M07), clone 3H1
  • SMAD4 monoclonal antibody (M07), clone 3H1

SMAD4 monoclonal antibody (M07), clone 3H1

Ref: AB-H00004089-M07
SMAD4 monoclonal antibody (M07), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMAD4.
Información adicional
Size 100 ug
Gene Name SMAD4
Gene Alias DPC4|JIP|MADH4
Gene Description SMAD family member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD4 (NP_005350, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4089
Clone Number 3H1
Iso type IgG2a Kappa

Enviar un mensaje


SMAD4 monoclonal antibody (M07), clone 3H1

SMAD4 monoclonal antibody (M07), clone 3H1