SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)

SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004088-D01P
SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMAD3 protein.
Información adicional
Size 100 ug
Gene Name SMAD3
Gene Alias DKFZp586N0721|DKFZp686J10186|HSPC193|HsT17436|JV15-2|MADH3|MGC60396
Gene Description SMAD family member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMAD3 (-, 31 a.a. ~ 141 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4088

Enviar un mensaje


SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)

SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)