MAD2L1 polyclonal antibody (A01)
  • MAD2L1 polyclonal antibody (A01)

MAD2L1 polyclonal antibody (A01)

Ref: AB-H00004085-A01
MAD2L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MAD2L1.
Información adicional
Size 50 uL
Gene Name MAD2L1
Gene Alias HSMAD2|MAD2
Gene Description MAD2 mitotic arrest deficient-like 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAD2L1 (AAH00356, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4085

Enviar un mensaje


MAD2L1 polyclonal antibody (A01)

MAD2L1 polyclonal antibody (A01)