MXD1 monoclonal antibody (M03), clone 2G10
  • MXD1 monoclonal antibody (M03), clone 2G10

MXD1 monoclonal antibody (M03), clone 2G10

Ref: AB-H00004084-M03
MXD1 monoclonal antibody (M03), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MXD1.
Información adicional
Size 100 ug
Gene Name MXD1
Gene Alias MAD|MAD1|MGC104659
Gene Description MAX dimerization protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,ELISA
Immunogen Prot. Seq THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MXD1 (NP_002348.1, 60 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4084
Clone Number 2G10
Iso type IgG1 Kappa

Enviar un mensaje


MXD1 monoclonal antibody (M03), clone 2G10

MXD1 monoclonal antibody (M03), clone 2G10