M6PR polyclonal antibody (A01)
  • M6PR polyclonal antibody (A01)

M6PR polyclonal antibody (A01)

Ref: AB-H00004074-A01
M6PR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant M6PR.
Información adicional
Size 50 uL
Gene Name M6PR
Gene Alias CD-MPR|FLJ32994|MPR46|SMPR
Gene Description mannose-6-phosphate receptor (cation dependent)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen M6PR (NP_002346, 211 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4074

Enviar un mensaje


M6PR polyclonal antibody (A01)

M6PR polyclonal antibody (A01)