LY6E purified MaxPab rabbit polyclonal antibody (D01P)
  • LY6E purified MaxPab rabbit polyclonal antibody (D01P)

LY6E purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004061-D01P
LY6E purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LY6E protein.
Información adicional
Size 100 ug
Gene Name LY6E
Gene Alias RIG-E|RIGE|SCA-2|SCA2|TSA-1
Gene Description lymphocyte antigen 6 complex, locus E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LY6E (NP_002337.1, 1 a.a. ~ 131 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4061

Enviar un mensaje


LY6E purified MaxPab rabbit polyclonal antibody (D01P)

LY6E purified MaxPab rabbit polyclonal antibody (D01P)