LUM purified MaxPab rabbit polyclonal antibody (D01P)
  • LUM purified MaxPab rabbit polyclonal antibody (D01P)

LUM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004060-D01P
LUM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LUM protein.
Información adicional
Size 100 ug
Gene Name LUM
Gene Alias LDC|SLRR2D
Gene Description lumican
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LUM (NP_002336.1, 1 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4060

Enviar un mensaje


LUM purified MaxPab rabbit polyclonal antibody (D01P)

LUM purified MaxPab rabbit polyclonal antibody (D01P)