BCAM polyclonal antibody (A01)
  • BCAM polyclonal antibody (A01)

BCAM polyclonal antibody (A01)

Ref: AB-H00004059-A01
BCAM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCAM.
Información adicional
Size 50 uL
Gene Name BCAM
Gene Alias AU|CD239|LU|MSK19
Gene Description basal cell adhesion molecule (Lutheran blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCAM (NP_005572, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4059

Enviar un mensaje


BCAM polyclonal antibody (A01)

BCAM polyclonal antibody (A01)