LTBP2 monoclonal antibody (M01), clone 5D7
  • LTBP2 monoclonal antibody (M01), clone 5D7

LTBP2 monoclonal antibody (M01), clone 5D7

Ref: AB-H00004053-M01
LTBP2 monoclonal antibody (M01), clone 5D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LTBP2.
Información adicional
Size 100 ug
Gene Name LTBP2
Gene Alias C14orf141|LTBP3|MSTP031
Gene Description latent transforming growth factor beta binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LTBP2 (NP_000419, 1709 a.a. ~ 1818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4053
Clone Number 5D7
Iso type IgG2a Kappa

Enviar un mensaje


LTBP2 monoclonal antibody (M01), clone 5D7

LTBP2 monoclonal antibody (M01), clone 5D7