CYP4F3 monoclonal antibody (M01), clone 4E11
  • CYP4F3 monoclonal antibody (M01), clone 4E11

CYP4F3 monoclonal antibody (M01), clone 4E11

Ref: AB-H00004051-M01
CYP4F3 monoclonal antibody (M01), clone 4E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYP4F3.
Información adicional
Size 100 ug
Gene Name CYP4F3
Gene Alias CPF3|CYP4F|LTB4H
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4051
Clone Number 4E11
Iso type IgG2b Kappa

Enviar un mensaje


CYP4F3 monoclonal antibody (M01), clone 4E11

CYP4F3 monoclonal antibody (M01), clone 4E11