Ver mas grande
LTA monoclonal antibody (M05), clone 1G2
AB-H00004049-M05
Producto nuevo
LTA monoclonal antibody (M05), clone 1G2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LTA |
| Gene Alias | LT|TNFB|TNFSF1 |
| Gene Description | lymphotoxin alpha (TNF superfamily, member 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Form | Liquid |
| Recomended Dilution | The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA. |
| Storage Buffer | In PBS, pH 7.2 |
| Gene ID | 4049 |
| Clone Number | 1G2 |
| Iso type | IgG1, kappa |
| Conjugation | Flag/His |
Más información
Mouse monoclonal antibody raised against a partial recombinant LTA.