LSP1 MaxPab rabbit polyclonal antibody (D01)
  • LSP1 MaxPab rabbit polyclonal antibody (D01)

LSP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004046-D01
LSP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LSP1 protein.
Información adicional
Size 100 uL
Gene Name LSP1
Gene Alias WP34|pp52
Gene Description lymphocyte-specific protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGTLDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LSP1 (AAH01785.1, 1 a.a. ~ 339 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4046

Enviar un mensaje


LSP1 MaxPab rabbit polyclonal antibody (D01)

LSP1 MaxPab rabbit polyclonal antibody (D01)