LSAMP purified MaxPab mouse polyclonal antibody (B01P)
  • LSAMP purified MaxPab mouse polyclonal antibody (B01P)

LSAMP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004045-B01P
LSAMP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LSAMP protein.
Información adicional
Size 50 ug
Gene Name LSAMP
Gene Alias IGLON3|LAMP
Gene Description limbic system-associated membrane protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LSAMP (AAH33803, 29 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4045

Enviar un mensaje


LSAMP purified MaxPab mouse polyclonal antibody (B01P)

LSAMP purified MaxPab mouse polyclonal antibody (B01P)