LOXL2 polyclonal antibody (A01)
  • LOXL2 polyclonal antibody (A01)

LOXL2 polyclonal antibody (A01)

Ref: AB-H00004017-A01
LOXL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LOXL2.
Información adicional
Size 50 uL
Gene Name LOXL2
Gene Alias LOR2|WS9-14
Gene Description lysyl oxidase-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4017

Enviar un mensaje


LOXL2 polyclonal antibody (A01)

LOXL2 polyclonal antibody (A01)