LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)
  • LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)

LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004013-B01P
LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LOH11CR2A protein.
Información adicional
Size 50 ug
Gene Name VWA5A
Gene Alias BCSC-1|BCSC1|LOH11CR2A
Gene Description von Willebrand factor A domain containing 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGALRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LOH11CR2A (NP_055437.2, 1 a.a. ~ 786 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4013

Enviar un mensaje


LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)

LOH11CR2A purified MaxPab mouse polyclonal antibody (B01P)