FADS3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FADS3 purified MaxPab rabbit polyclonal antibody (D01P)

FADS3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003995-D01P
FADS3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FADS3 protein.
Información adicional
Size 100 ug
Gene Name FADS3
Gene Alias CYB5RP|LLCDL3
Gene Description fatty acid desaturase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQAAEDMKLFDASPTFFAFLLGHILAMEVLAWLLIYLLGPGWVPSALAAFILAISQAQSWCLQHDLGHASIFKKSWWNHVAQKFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPVFLLGESSVEYGKKKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FADS3 (NP_068373.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3995

Enviar un mensaje


FADS3 purified MaxPab rabbit polyclonal antibody (D01P)

FADS3 purified MaxPab rabbit polyclonal antibody (D01P)