LLGL2 MaxPab rabbit polyclonal antibody (D01)
  • LLGL2 MaxPab rabbit polyclonal antibody (D01)

LLGL2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003993-D01
LLGL2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LLGL2 protein.
Información adicional
Size 100 uL
Gene Name LLGL2
Gene Alias HGL|LGL2
Gene Description lethal giant larvae homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LLGL2 (AAH64994.1, 1 a.a. ~ 1020 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3993

Enviar un mensaje


LLGL2 MaxPab rabbit polyclonal antibody (D01)

LLGL2 MaxPab rabbit polyclonal antibody (D01)