FADS1 polyclonal antibody (A01)
  • FADS1 polyclonal antibody (A01)

FADS1 polyclonal antibody (A01)

Ref: AB-H00003992-A01
FADS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FADS1.
Información adicional
Size 50 uL
Gene Name FADS1
Gene Alias D5D|FADS6|FADSD5|FLJ38956|FLJ90273|LLCDL1|TU12
Gene Description fatty acid desaturase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FADS1 (NP_037534, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3992

Enviar un mensaje


FADS1 polyclonal antibody (A01)

FADS1 polyclonal antibody (A01)