LIG4 monoclonal antibody (M01), clone 1A4
  • LIG4 monoclonal antibody (M01), clone 1A4

LIG4 monoclonal antibody (M01), clone 1A4

Ref: AB-H00003981-M01
LIG4 monoclonal antibody (M01), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LIG4.
Información adicional
Size 100 ug
Gene Name LIG4
Gene Alias -
Gene Description ligase IV, DNA, ATP-dependent
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LIG4 (AAH37491, 802 a.a. ~ 911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3981
Clone Number 1A4
Iso type IgG2a kappa

Enviar un mensaje


LIG4 monoclonal antibody (M01), clone 1A4

LIG4 monoclonal antibody (M01), clone 1A4