LIG3 polyclonal antibody (A01)
  • LIG3 polyclonal antibody (A01)

LIG3 polyclonal antibody (A01)

Ref: AB-H00003980-A01
LIG3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LIG3.
Información adicional
Size 50 uL
Gene Name LIG3
Gene Alias LIG2
Gene Description ligase III, DNA, ATP-dependent
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LIG3 (NP_039269, 823 a.a. ~ 922 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3980

Enviar un mensaje


LIG3 polyclonal antibody (A01)

LIG3 polyclonal antibody (A01)