LIFR polyclonal antibody (A01)
  • LIFR polyclonal antibody (A01)

LIFR polyclonal antibody (A01)

Ref: AB-H00003977-A01
LIFR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LIFR.
Información adicional
Size 50 uL
Gene Name LIFR
Gene Alias CD118|FLJ98106|FLJ99923|LIF-R|SJS2|STWS|SWS
Gene Description leukemia inhibitory factor receptor alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LIFR (NP_002301, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3977

Enviar un mensaje


LIFR polyclonal antibody (A01)

LIFR polyclonal antibody (A01)