LHX1 monoclonal antibody (M09), clone 4A5 Ver mas grande

LHX1 monoclonal antibody (M09), clone 4A5

AB-H00003975-M09

Producto nuevo

LHX1 monoclonal antibody (M09), clone 4A5

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name LHX1
Gene Alias LIM-1|LIM1|MGC126723|MGC138141
Gene Description LIM homeobox 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3975
Clone Number 4A5
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant LHX1.

Consulta sobre un producto

LHX1 monoclonal antibody (M09), clone 4A5

LHX1 monoclonal antibody (M09), clone 4A5