LHX1 polyclonal antibody (A01)
  • LHX1 polyclonal antibody (A01)

LHX1 polyclonal antibody (A01)

Ref: AB-H00003975-A01
LHX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LHX1.
Información adicional
Size 50 uL
Gene Name LHX1
Gene Alias LIM-1|LIM1|MGC126723|MGC138141
Gene Description LIM homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX1 (NP_005559, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3975

Enviar un mensaje


LHX1 polyclonal antibody (A01)

LHX1 polyclonal antibody (A01)