LGALS9 polyclonal antibody (A01)
  • LGALS9 polyclonal antibody (A01)

LGALS9 polyclonal antibody (A01)

Ref: AB-H00003965-A01
LGALS9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LGALS9.
Información adicional
Size 50 uL
Gene Name LGALS9
Gene Alias HUAT|LGALS9A|MGC117375|MGC125973|MGC125974
Gene Description lectin, galactoside-binding, soluble, 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LGALS9 (NP_033665, 254 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3965

Enviar un mensaje


LGALS9 polyclonal antibody (A01)

LGALS9 polyclonal antibody (A01)