LGALS4 polyclonal antibody (A01)
  • LGALS4 polyclonal antibody (A01)

LGALS4 polyclonal antibody (A01)

Ref: AB-H00003960-A01
LGALS4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LGALS4.
Información adicional
Size 50 uL
Gene Name LGALS4
Gene Alias GAL4|L36LBP
Gene Description lectin, galactoside-binding, soluble, 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LGALS4 (NP_006140, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3960

Enviar un mensaje


LGALS4 polyclonal antibody (A01)

LGALS4 polyclonal antibody (A01)