LEPR monoclonal antibody (M05), clone 2H5
  • LEPR monoclonal antibody (M05), clone 2H5

LEPR monoclonal antibody (M05), clone 2H5

Ref: AB-H00003953-M05
LEPR monoclonal antibody (M05), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LEPR.
Información adicional
Size 100 ug
Gene Name LEPR
Gene Alias CD295|OBR
Gene Description leptin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEPR (NP_001003679, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3953
Clone Number 2H5
Iso type IgG1 Kappa

Enviar un mensaje


LEPR monoclonal antibody (M05), clone 2H5

LEPR monoclonal antibody (M05), clone 2H5