LEP monoclonal antibody (M01), clone 3G1-1C9
  • LEP monoclonal antibody (M01), clone 3G1-1C9

LEP monoclonal antibody (M01), clone 3G1-1C9

Ref: AB-H00003952-M01
LEP monoclonal antibody (M01), clone 3G1-1C9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LEP.
Información adicional
Size 100 ug
Gene Name LEP
Gene Alias FLJ94114|OB|OBS
Gene Description leptin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEP (AAH60830.1, 22 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3952
Clone Number 3G1-1C9
Iso type IgG2b Kappa

Enviar un mensaje


LEP monoclonal antibody (M01), clone 3G1-1C9

LEP monoclonal antibody (M01), clone 3G1-1C9