LDLR monoclonal antibody (M02A), clone 5E6
  • LDLR monoclonal antibody (M02A), clone 5E6

LDLR monoclonal antibody (M02A), clone 5E6

Ref: AB-H00003949-M02A
LDLR monoclonal antibody (M02A), clone 5E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LDLR.
Información adicional
Size 200 uL
Gene Name LDLR
Gene Alias FH|FHC
Gene Description low density lipoprotein receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LDLR (NP_000518, 105 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3949
Clone Number 5E6
Iso type IgG2a Kappa

Enviar un mensaje


LDLR monoclonal antibody (M02A), clone 5E6

LDLR monoclonal antibody (M02A), clone 5E6