LDLR polyclonal antibody (A01)
  • LDLR polyclonal antibody (A01)

LDLR polyclonal antibody (A01)

Ref: AB-H00003949-A01
LDLR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LDLR.
Información adicional
Size 50 uL
Gene Name LDLR
Gene Alias FH|FHC
Gene Description low density lipoprotein receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LDLR (NP_000518, 105 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3949

Enviar un mensaje


LDLR polyclonal antibody (A01)

LDLR polyclonal antibody (A01)