LDHA MaxPab rabbit polyclonal antibody (D01)
  • LDHA MaxPab rabbit polyclonal antibody (D01)

LDHA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003939-D01
LDHA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LDHA protein.
Información adicional
Size 100 uL
Gene Name LDHA
Gene Alias LDH-M|LDH1|PIG19
Gene Description lactate dehydrogenase A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3939

Enviar un mensaje


LDHA MaxPab rabbit polyclonal antibody (D01)

LDHA MaxPab rabbit polyclonal antibody (D01)