LCT monoclonal antibody (M01), clone 3H6
  • LCT monoclonal antibody (M01), clone 3H6

LCT monoclonal antibody (M01), clone 3H6

Ref: AB-H00003938-M01
LCT monoclonal antibody (M01), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LCT.
Información adicional
Size 100 ug
Gene Name LCT
Gene Alias LAC|LPH|LPH1
Gene Description lactase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AGPLTNDLLHNLSGLLGDQSSNFVAGDKDMYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKALKTARLQPMV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCT (NP_002290, 32 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3938
Clone Number 3H6
Iso type IgG1 Kappa

Enviar un mensaje


LCT monoclonal antibody (M01), clone 3H6

LCT monoclonal antibody (M01), clone 3H6