LCK monoclonal antibody (M11), clone 3H5
  • LCK monoclonal antibody (M11), clone 3H5

LCK monoclonal antibody (M11), clone 3H5

Ref: AB-H00003932-M11
LCK monoclonal antibody (M11), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LCK.
Información adicional
Size 100 ug
Gene Name LCK
Gene Alias YT16|p56lck|pp58lck
Gene Description lymphocyte-specific protein tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCK (AAH13200, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3932
Clone Number 3H5
Iso type IgG2a Kappa

Enviar un mensaje


LCK monoclonal antibody (M11), clone 3H5

LCK monoclonal antibody (M11), clone 3H5