LCAT monoclonal antibody (M01), clone 4A9
  • LCAT monoclonal antibody (M01), clone 4A9

LCAT monoclonal antibody (M01), clone 4A9

Ref: AB-H00003931-M01
LCAT monoclonal antibody (M01), clone 4A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LCAT.
Información adicional
Size 100 ug
Gene Name LCAT
Gene Alias -
Gene Description lecithin-cholesterol acyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq CWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LCAT (AAH14781, 98 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3931
Clone Number 4A9
Iso type IgG2a Kappa

Enviar un mensaje


LCAT monoclonal antibody (M01), clone 4A9

LCAT monoclonal antibody (M01), clone 4A9