STMN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • STMN1 purified MaxPab rabbit polyclonal antibody (D01P)

STMN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003925-D01P
STMN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STMN1 protein.
Información adicional
Size 100 ug
Gene Name STMN1
Gene Alias LAP18|Lag|OP18|PP17|PP19|PR22|SMN
Gene Description stathmin 1/oncoprotein 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STMN1 (NP_005554.1, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3925

Enviar un mensaje


STMN1 purified MaxPab rabbit polyclonal antibody (D01P)

STMN1 purified MaxPab rabbit polyclonal antibody (D01P)