LAMP2 polyclonal antibody (A01)
  • LAMP2 polyclonal antibody (A01)

LAMP2 polyclonal antibody (A01)

Ref: AB-H00003920-A01
LAMP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LAMP2.
Información adicional
Size 50 uL
Gene Name LAMP2
Gene Alias CD107b|LAMPB|LGP110
Gene Description lysosomal-associated membrane protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3920

Enviar un mensaje


LAMP2 polyclonal antibody (A01)

LAMP2 polyclonal antibody (A01)